HORDB

ID: hor005930
Uniprot ID: P06299
Protein name: Beta-endorphin
Gene name: pomc-b
Organism: Xenopus laevis (African clawed frog)
Family: POMC family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: YGGFMTPERSQTPLMTLFKNAIIKNTHKKGL
Length: 31
Propeptide: MFRPTGGCSLAILGVFIFHIGEVQSQCWESSRCADLSSEDGILECIKACKMDLSAESPVFPGNGHLQPLSESIRKYVMTHFRWNKFGRRNNTGNDGSSGGYKREDISNYPVLNLFPSSDNQNAQGDNMEEEPMDRQENKRAYSMEHFRWGKPVGRKRRPIKVYPNGVEEESAESFPMELRRELSLELDYPEIDLDEDIEDNEVERALTKKNGNYRMHHFRWGSPPKDKRYGGFMTPERSQTPLMTLFKNAIIKNTHKKGL
Signal peptide: MFRPTGGCSLAILGVFIFHIGEVQS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocyte-stimulating hormone beta]: Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Beta-endorphin]: Endogenous orexigenic opiate.; [Met-enkephalin]: Endogenous opiate.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005930_AF2.pdb

hor005930_ESM.pdb

Mass:	405845	Formula:	C159H257N43O43S2
Absent amino acids:	CDVW	Common amino acids:	KT
pI:	10.86	Basic residues:	6
Polar residues:	11	Hydrophobic residues:	8
Hydrophobicity:	-48.39	Boman Index:	-4134
Half-Life:	2.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	2 min	Aliphatic Index	66.13
Instability Index:	2962.9	Extinction Coefficient cystines:	1490
Absorbance 280nm:	49.67

PubMed ID: 1915355
Title: Structural analysis of the entire proopiomelanocortin gene of Xenopus laevis.
PubMed ID: 3754961
Title: Expression of two proopiomelanocortin genes in the pituitary gland of Xenopus laevis: complete structures of the two preprohormones.
PubMed ID: 3595598
Title: Structural organization of the proopiomelanocortin gene in Xenopus laevis. 5'-end homologies within the toad and mammalian genes.
PubMed ID: 2564347
Title: Particular processing of pro-opiomelanocortin in Xenopus laevis intermediate pituitary. Sequencing of alpha- and beta-melanocyte-stimulating hormones.